PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI09G18880.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 260aa    MW: 28343.6 Da    PI: 5.5999
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI09G18880.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.99.5e-087361948
                     TTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 19 lGggtWktIartmgkgRtlkqcksrwqkyl 48
                      G  +W+++++  g+ R++k+c++rw +yl
  ORUFI09G18880.3  7 NGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 36
                     57779*********99************97 PP

2Myb_DNA-binding53.45.8e-174586447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      T  E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  ORUFI09G18880.3 45 LTDAEEQLVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 86
                     5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.133136IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.3E-11342IPR009057Homeodomain-like
PfamPF002493.6E-6736IPR001005SANT/Myb domain
SuperFamilySSF466892.45E-212395IPR009057Homeodomain-like
PROSITE profilePS5129428.0323791IPR017930Myb domain
SMARTSM007172.2E-154189IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-254392IPR009057Homeodomain-like
PfamPF002497.1E-154586IPR001005SANT/Myb domain
CDDcd001677.99E-134687No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MSFILTNGHC CWRAVPKLAG LLRCGKSCRL RWTNYLRPDL KRGLLTDAEE QLVIDLHAKL  60
GNRWSKIAAK LPGRTDNEIK NHWNTHIKKK LIKMGIDPVT HEPLDRKQES PATTSQSTVT  120
AESSKSGEAT RQQSRQLDDA VVRDMSVSAG GDSPPESSTN TASTAGGSSS SSSSHHQDPL  180
VKWLLEEDLL PTGDEPWLNF TASNDVDEFS SIAATGATPA LPWDVGMTTD WLLDYQDFGM  240
GDSSLVVDAS MVNSSNGSNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-20239140108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3110520.0AJ311052.1 Oryza sativa mRNA for Myb13 protein (myb13 gene).
GenBankAJ3110530.0AJ311053.1 Oryza sativa mRNA for Myb15 protein (myb15 gene).
GenBankAK1117400.0AK111740.1 Oryza sativa Japonica Group cDNA clone:J023047I22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612209.10.0PREDICTED: protein ODORANT1
RefseqXP_015612208.10.0PREDICTED: protein ODORANT1
RefseqXP_015612207.10.0PREDICTED: protein ODORANT1
RefseqXP_015612206.10.0PREDICTED: protein ODORANT1
RefseqXP_015612205.10.0PREDICTED: protein ODORANT1
RefseqXP_015612204.10.0PREDICTED: protein ODORANT1
RefseqXP_015612203.10.0PREDICTED: protein ODORANT1
RefseqXP_015612201.10.0PREDICTED: protein ODORANT1
RefseqXP_015612200.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX69e-75ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0E0QUA40.0A0A0E0QUA4_ORYRU; Uncharacterized protein
STRINGBGIOSGA029380-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os09g36250.10.0(Oryza sativa Japonica Group)
STRINGORGLA09G0137500.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.16e-68myb domain protein 42